Join the Best B2B Marketplace Get Up To 60% OFF
exporthub-common-header
Countries

Source From Global Centrifuge Tube Manufacturers and Suppliers

Related Searches:

Centrifuge Tube Manufacturers

Centrifuge Tube Importers Total Records 71

  • Model : 5CT-3913041
  • MOQ : 100000KGs
  • Port : China
  • Capacity : 100
  • Packaging : Standard
  • Delivery : 8
  • Certification: BRC
  • Rating : 2.8 (12 Reviews)
Price: USD 0.05/KGs
This product is also available on Amazon for retail. More Detail

Nantong, China
Premium Membership
Amazon Services
  • Response Rate: 81%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Anna Shi
  • Payment Methods : T/T, MoneyGramBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Is It Reusable:Non Reusable, Reusable
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Shape:Conical, Cylindrical, Circular, Other
  • Metal Clamp:Yes,
  • ...
Show Attributes Hide Attributes

  • Serological Pipette, Pasteur Pipette,centrifuge Tube,cryovial Tube,sampling Loop,specimen Containers,cell Spreader Etc from Aude medical sicence and technology development co., Ltd
  • Model SPPPTTLCSE-086
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 920 Pieces
  • Delivery Time 19-20 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high
  • Certification ohsas18001
  • Rating 3.8 (13 reviews).
Price: USD 0.01/Pieces

Beijing, China 1st Year
Free Member
  • Response Rate: 75%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: stone lee
  • Payment Methods : T/T, CashBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Shape:Conical, Cylindrical, Circular, Other
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Metal Clamp:Yes, No
  • Is It Reusable:Non Reusable, Reusa
  • ...
Show Attributes Hide Attributes

  • Elastic Latex Free Bandages, Everready Flashlights, Cambro Coffee Mugs, Libbey Glass Ashtrays, Kimble Glass Disposable Centrifuge Tubes from All American Sales Inc.
  • Model ELFBEFCCMLGAKGDCT-099
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1100 Pieces
  • Delivery Time 13-14 Business Days
  • Shipping Port United States
  • Packaging Standard
  • Capacity huge
  • Certification iso13485
  • Rating 4 (5 reviews).
Price: USD 0.01/Pieces

Saint Louis, United States 1st Year
Free Member
  • Response Rate: 86%
  • Currency: USD
  • Language: English
  • Contact Person: Joe
  • Payment Methods : T/T, L/CBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Metal Clamp:Yes, No
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Is It Reusable:Non Reusable, Reusable
  • Shape:Conical, Cylindrical, Circular, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • I deal in:New Only, New and Second Hand, Second Hand O
  • ...
Show Attributes Hide Attributes

  • Petri Dishes, Pipette Tips, Micro Centrifuge Tubes, Gloves from Biogem Scientific
  • Model PDPTMCTG-036
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1500 Pieces
  • Delivery Time 15-16 Business Days
  • Shipping Port India
  • Packaging Standard
  • Capacity huge
  • Certification fsc
  • Rating 1.8 (16 reviews).
Price: USD 0.01/Pieces

Solan, India 1st Year
Free Member
  • Response Rate: 86%
  • Currency: INR,USD
  • Language: English, Hindi
  • Contact Person: Saurabh
  • Payment Methods : T/T, MoneyGramBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Shape:Conical, Cylindrical, Circular, Other
  • Is It Reusable:Non Reusable, Reusable
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Metal Clamp:Yes, No
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Gl
  • ...
Show Attributes Hide Attributes

  • Centrifuge Tube, Petri Dish,test Tube from Bohan Laboratory Consumable Co.,Ltd.
  • Model CTPDT-04
  • Price $0 Per Pieces
  • Minimum Order Quantity 930 Pieces
  • Delivery Time 19-20 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high
  • Certification iso9001
  • Rating 1.6 (30 reviews).
Price: Inquire

Beijing, China 1st Year
Free Member
  • Response Rate: 79%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: catherine xu
  • Payment Methods : T/T, CashBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Metal Clamp:Yes, No
  • Shape:Conical, Cylindrical, Circular, Other
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Is It Reusable:Non Reusable, Reusable
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Gl
  • ...
Show Attributes Hide Attributes

  • Tese Tubes,centrifuge Tubes,culture Dish,pipette,slide And Other Lab Consumables from Nantong Qingmao Lab Consumable Instrument Co., Ltd.
  • Model TTTDAOLC-070
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 940 Pieces
  • Delivery Time 14-15 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high volume
  • Certification bsci
  • Rating 4.8 (25 reviews).
Price: USD 0.01/Pieces

Nantong, China 1st Year
Free Member
  • Response Rate: 82%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: lonyi liu
  • Payment Methods : T/T, Western UnionBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Is It Reusable:Non Reusable, Reusable
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Shape:Conical, Cylindrical, Circular, Other
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Metal Clamp:Yes, No
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Gl
  • ...
Show Attributes Hide Attributes

  • Plastic Laboratory Consumables,Microscope Slide Box,Cryo Boxes With Grids,Tip-box Empty,Centrifugal Tube Box,Centrifugal Tube ,Petri Dishes,Microcentrifuge Tube Rack from jie&lin
  • Model PLCSBBWGETBTDTR-0100
  • Price $0 Per Pieces
  • Minimum Order Quantity 1200 Pieces
  • Delivery Time 17-18 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity large
  • Certification bsci
  • Rating 3.2 (20 reviews).
Price: Inquire

Nantong, China 1st Year
Free Member
  • Response Rate: 99%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: berton lu
  • Payment Methods : T/T, Western UnionBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Metal Clamp:Yes, No
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Shape:Conical, Cylindrical, Circular, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • ...
Show Attributes Hide Attributes

  • Test Tube,pipette Tips,centrifuge Tube,petri Dish,plate,pcr Tube,pcr Plate,reagent Bottle,cryo Tube,urine Container,stool Container from Nantong Qingmao Lab Consumable Instrument Co.,ltd
  • Model TTTTDTPBTCC-066
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 960 Pieces
  • Delivery Time 14-15 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high
  • Certification gsv
  • Rating 3.4 (1 reviews).
Price: USD 0.01/Pieces

Beijing, China 1st Year
Free Member
  • Response Rate: 92%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: alina xiang
  • Payment Methods : T/T, D/PBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Metal Clamp:Yes, No
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Is It Reusable:Non Reusable, Reusable
  • Shape:Conical, Cylindrical, Circular, Ot
  • ...
Show Attributes Hide Attributes

  • Pipette Tip, Centrifuge Tube, PCR Tube from Shangyu Yite Plastic CO,. Ltd.
  • Model PTCTPT-02
  • Price $0 Per Pieces
  • Minimum Order Quantity 800 Pieces
  • Delivery Time 6-7 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification ohsas18001
  • Rating 1.9 (23 reviews).
Price: Inquire

Shaoxing, China 1st Year
Free Member
  • Response Rate: 79%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Elise Soong
  • Payment Methods : T/T, CashBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Shape:Conical, Cylindrical, Circular, Other
  • Is It Reusable:Non Reusable, Reusable
  • Metal Clamp:Yes, No
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Automation Grade:Semi-Automatic, Automatic, Man
  • ...
Show Attributes Hide Attributes

  • Centrifuge Tubes, Pipet Tips, Microcentrifuge Tubes, Cryogenic Vials, Petri Dish, Cryogenic Boxes, Cardboard Boxes, PCR Tubes, Laboratory Plastics from Asgen plastics Co., Ltd.
  • Model CTPTMTCVPDCBCBPTLP-085
  • Price $0 Per Pieces
  • Minimum Order Quantity 540 Pieces
  • Delivery Time 7-8 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high
  • Certification fsc
  • Rating 3.8 (9 reviews).
Price: Inquire

Haimen, China 1st Year
Free Member
  • Response Rate: 85%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Cathy
  • Payment Methods : T/T, EscrowBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Is It Reusable:Non Reusable, Reusable
  • Shape:Conical, Cylindrical, Circular, Other
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Metal Clamp:Yes,
  • ...
Show Attributes Hide Attributes

  • Petri Dish, Test Tube, Centrifuge Tube, Pipette Tips, Specimen Container from Zhejiang Aicor Technology Co.,ltd
  • Model PDTTCTPTSC-028
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1500 Pieces
  • Delivery Time 19-20 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification fsc
  • Rating 3.5 (28 reviews).
Price: USD 0.01/Pieces

Taizhou, China 1st Year
Free Member
  • Response Rate: 75%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Simon Bao
  • Payment Methods : T/T, CashBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Is It Reusable:Non Reusable, Reusable
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Metal Clamp:Yes, No
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Shape:Conical, Cylindrical, Circular, Other
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • ...
Show Attributes Hide Attributes

  • Vacuum Blood Collection Tube,transfer Pipette,specimen Container,sample Cup,centrifuge Tube,cuvette from Jiangsu Kangjian Medical Apparatus Co., Ltd
  • Model VBCTPCCT-038
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 660 Pieces
  • Delivery Time 17-18 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high
  • Certification iso/ts16949
  • Rating 4.3 (2 reviews).
Price: USD 0.01/Pieces

Taizhou, China 1st Year
Free Member
  • Response Rate: 81%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Daniel
  • Payment Methods : T/T, CashBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Metal Clamp:Yes, No
  • Shape:Conical, Cylindrical, Circular, Other
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Is It Reusable:Non Reusable, Reusable
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • ...
Show Attributes Hide Attributes

  • Syring Filter,sample Vial ,centrifuge Tube , from Membrane Solutions,LLC
  • Model SFVT-011
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 880 Pieces
  • Delivery Time 19-20 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification iso/ts16949
  • Rating 3.5 (16 reviews).
Price: USD 0.01/Pieces

Wuhan, China 1st Year
Free Member
  • Response Rate: 83%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: zhang min
  • Payment Methods : T/T, D/ABank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Metal Clamp:Yes, No
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Shape:Conical, Cylindrical, Circular, Other
  • Is It Reusable:Non Reusable, Reusable
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Gl
  • ...
Show Attributes Hide Attributes

  • Plastic Labware, Like Embedding Cassettes, Petri Dishes, Sample Cups, Pasteur Pipettes, Pipette Tips, Freezing Tubes, Centrifuge Tubes, Test Tubes And Etc from YANCHENG HUIDA MEDICAL INSTRUMENTS CO., LTD.
  • Model PLLECPDSCPPPTFTCTTTAE-081
  • Price $0 Per Pieces
  • Minimum Order Quantity 1100 Pieces
  • Delivery Time 8-9 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification gsv
  • Rating 4.2 (3 reviews).
Price: Inquire

Yancheng, China 1st Year
Free Member
  • Response Rate: 87%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: fen guo
  • Payment Methods : T/T, EscrowBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Is It Reusable:Non Reusable, Reusable
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Metal Clamp:Yes, No
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Shape:Conical, Cylindrical, Circular, Ot
  • ...
Show Attributes Hide Attributes

  • Serological Pipette,pasteur Pipette,cryovial Tube, Centrifuge Tube,samping Loops, Specimen Containers,cell Spreaders from Shanghai Aude Medical Science & Technology Development Co., ltd
  • Model SPPTCTLSCS-059
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 930 Pieces
  • Delivery Time 12-13 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification tl9000
  • Rating 2.8 (19 reviews).
Price: USD 0.01/Pieces

Shanghai, China 1st Year
Free Member
  • Response Rate: 79%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: stone
  • Payment Methods : T/T, D/ABank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Is It Reusable:Non Reusable, Reusable
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Metal Clamp:Yes, No
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Shape:Conical, Cylindrical, Circular, Other
  • ...
Show Attributes Hide Attributes

  • Centrifuge Tube,pipette Tips,PCR Tube,tips from SHANGYUSHI YITE PLASTIC CO., LTD
  • Model CTTT-074
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 860 Pieces
  • Delivery Time 1-2 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high volume
  • Certification iso13485
  • Rating 1 (18 reviews).
Price: USD 0.01/Pieces

Shaoxing, China 1st Year
Free Member
  • Response Rate: 92%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: YAYA LUO
  • Payment Methods : T/T, D/PBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Is It Reusable:Non Reusable, Reusable
  • Shape:Conical, Cylindrical, Circular, Other
  • Metal Clamp:Yes, No
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • I deal in:New Only, New and Second Hand, Second Hand O
  • ...
Show Attributes Hide Attributes

  • Centrifuge Tube, Micro Centrifuge Tube, Storage Vial, Cryo Vial, Ria Vial, Pipette Tips, Graduated Tips, Filter Tips, Serological Pipettes, Pasteur Pipettes Cell Culture Flasks, Tissue Culture Plates, from MOXCARE PRODUCTS INC.
  • Model CTMCTSVCVRVPTGTFTSPPPCCFTCPPTPPDWPCD-093
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1400 Pieces
  • Delivery Time 9-10 Business Days
  • Shipping Port India
  • Packaging Standard
  • Capacity high
  • Certification iso9001
  • Rating 1.3 (14 reviews).
Price: USD 0.01/Pieces

New Delhi, India 1st Year
Free Member
  • Response Rate: 87%
  • Currency: INR,USD
  • Language: English, Hindi
  • Contact Person: Manager
  • Payment Methods : T/T, L/CBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Is It Reusable:Non Reusable, Reusable
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Shape:Conical, Cylindrical, Circular, Other
  • Metal Clamp:Yes, No
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Gl
  • ...
Show Attributes Hide Attributes

  • Test Tube,Centrifuge Tube,Pipette Tip,Pasteur Pipette,Petri Dish from Jiangsu Haimen BaiDeFu laboratory consumables Co., LTD
  • Model TTTTPD-089
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1300 Pieces
  • Delivery Time 10-11 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high volume
  • Certification bsci
  • Rating 1.5 (17 reviews).
Price: USD 0.01/Pieces

Nantong, China 1st Year
Free Member
  • Response Rate: 94%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: saihua Chen
  • Payment Methods : T/T, MoneyGramBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Metal Clamp:Yes, No
  • Is It Reusable:Non Reusable, Reusable
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Shape:Conical, Cylindrical, Circular, Ot
  • ...
Show Attributes Hide Attributes

  • NDT Equipment And Accessories , Ultrasonic Probe, Normal Probe, Angle Probe, TR Probe, Straight Beam Probe, Ultrasonic Testing Cables, LEMO To LEMO Cable,LEMO TO MINI LEMO CABLE, BNC TO MINI LEMO CABL from KIRTI NDT AND ENGINEERING SERVICES
  • Model NEAAUPNPAPTPSBPUTCLTLCTMLCBTMLCMTBCMCML-044
  • Price $0 Per Pieces
  • Minimum Order Quantity 550 Pieces
  • Delivery Time 3-4 Business Days
  • Shipping Port India
  • Packaging Standard
  • Capacity high
  • Certification gmp
  • Rating 4.5 (7 reviews).
Price: Inquire

New Delhi, India 1st Year
Free Member
  • Response Rate: 89%
  • Currency: INR,USD
  • Language: English, Hindi
  • Contact Person: KIRTI
  • Payment Methods : T/T, PayPalBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Shape:Conical, Cylindrical, Circular, Other
  • Metal Clamp:Yes, No
  • ...
Show Attributes Hide Attributes

  • Cell Culture Plate, Cell Culture Dish, Cell Culture Flask, Centrifuge Tube from NEST BIOTECHNOLOGY Co., Ltd
  • Model CCPCCDCCFCT-090
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1200 Pieces
  • Delivery Time 18-19 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification iso/ts16949
  • Rating 1 (5 reviews).
Price: USD 0.01/Pieces

Beijing, China 1st Year
Free Member
  • Response Rate: 90%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: JoJo Ding
  • Payment Methods : T/T, D/PBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Shape:Conical, Cylindrical, Circular, Other
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Metal Clamp:Yes, No
  • Is It Reusable:Non Reusable, Reusable
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Gl
  • ...
Show Attributes Hide Attributes

  • Serological Pipets,centrifuge Tubes,tissue Culture Plate/flask/dish.elisa Plate from Guangzhou jet bio-filtration
  • Model SPTCPP-044
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1300 Pieces
  • Delivery Time 6-7 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high
  • Certification iso10012
  • Rating 1.3 (10 reviews).
Price: USD 0.01/Pieces

Guangzhou, China 1st Year
Free Member
  • Response Rate: 93%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: cherry zhang
  • Payment Methods : T/T, L/CBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Shape:Conical, Cylindrical, Circular, Other
  • Metal Clamp:Yes, No
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Is It Reusable:Non Reusable, Reusable
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • ...
Show Attributes Hide Attributes

  • Pipette Tip, Centrifuge Tubes, 96deep Well Plates, Latex Gloves from Kirgen Bioscience (Shanghai) Co., Ltd.
  • Model PTCT9WPLG-038
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1200 Pieces
  • Delivery Time 9-10 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification fsc
  • Rating 1.4 (15 reviews).
Price: USD 0.01/Pieces

Shanghai, China 1st Year
Free Member
  • Response Rate: 81%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Janet Ding
  • Payment Methods : T/T, PayPalBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Is It Reusable:Non Reusable, Reusable
  • Shape:Conical, Cylindrical, Circular, Other
  • Metal Clamp:Yes,
  • ...
Show Attributes Hide Attributes

  • Syringe, Insulin Syringe, Blood Collection Needle, Vacuum Tube, Injection Set, Vaginal Speculum, I.v.catheter, Stopcock& Heparin Cap, Transfer Pipette, Centrifugation Tube from Suzhou Coming Jianye Medical Technology Company
  • Model SISBCNVTISVSISHCTPCT-039
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1500 Pieces
  • Delivery Time 5-6 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification sa8000
  • Rating 1.4 (10 reviews).
Price: USD 0.01/Pieces

Suzhou, China 1st Year
Free Member
  • Response Rate: 95%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Sophia Zou
  • Payment Methods : T/T, EscrowBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Shape:Conical, Cylindrical, Circular, Other
  • Is It Reusable:Non Reusable, Reusable
  • Metal Clamp:Yes, No
  • ...
Show Attributes Hide Attributes

  • Centrifuge Tubes,Transfer Pipets,Micro Centrifuge Tubes,Cell And Tissue Culture Plates,Cell And Tissue Culture Flasks ,Cell And Tissue Culture Dishes,Syringe Driven Filters,ELISA Plates ,Pipette Micro from Guangzhou RongYu Biological technology Co. Ltd
  • Model CTPCTATCPATCFATCDDFPMTDTT-062
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1500 Pieces
  • Delivery Time 2-3 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity large
  • Certification iso/ts16949
  • Rating 2.5 (4 reviews).
Price: USD 0.01/Pieces

Guangzhou, China 1st Year
Free Member
  • Response Rate: 78%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: xiaohu kang
  • Payment Methods : T/T, CashBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Shape:Conical, Cylindrical, Circular, Other
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Is It Reusable:Non Reusable, Reusable
  • Metal Clamp:Yes, No
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Gl
  • ...
Show Attributes Hide Attributes

  • Centrifuge Tube,pipette Tip,test Tube,pasture Pipette,petri Dish,tube Stopper,embedding Cassettes,microscope Slides,cover Slips,etc. from haimenshukang
  • Model CTTTPDSCSS-08
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1400 Pieces
  • Delivery Time 10-11 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high
  • Certification iso17025
  • Rating 3.1 (13 reviews).
Price: USD 0.01/Pieces

Haimen, China 1st Year
Free Member
  • Response Rate: 100%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: jane wu
  • Payment Methods : T/T, Western UnionBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Metal Clamp:Yes, No
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Shape:Conical, Cylindrical, Circular, Other
  • Is It Reusable:Non Reusable, Reusable
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Ot
  • ...
Show Attributes Hide Attributes

  • Tips,Test Tube Transfer Pipettes,Centrifuge Tube,Cuvette Cup,Sample Cup,Medical Equipment,Tube Rack from Jiangsu Kangjie Medical Devices Co., Ltd
  • Model TTTPTCCER-032
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1400 Pieces
  • Delivery Time 1-2 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification bsci
  • Rating 4.2 (27 reviews).
Price: USD 0.01/Pieces

Taizhou, China 1st Year
Free Member
  • Response Rate: 97%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Amily you
  • Payment Methods : T/T, EscrowBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Is It Reusable:Non Reusable, Reusable
  • Shape:Conical, Cylindrical, Circular, Other
  • Metal Clamp:Yes, No
  • Automation Grade:Semi-Automatic, Automatic, Man
  • ...
Show Attributes Hide Attributes

  • Straw Hats,medical Items, Syringe,infusion Set, Urine Bag,nebulizer, Gauze Roll, Gauze Pad,gauze Bandage, Elastic Bandage, Lab Items, Vacuum Tube, Centrifuge Tube, Embedding Cassette,Pipette Tips, Mic from FO-REVERE INDUSTRY GROUP (CHINA) LIMITED
  • Model SHISSUBGRGPBEBLIVTCTECTMSMCSPD-085
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 930 Pieces
  • Delivery Time 7-8 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification fsc
  • Rating 1.1 (10 reviews).
Price: USD 0.01/Pieces

Shenzhen, China 1st Year
Free Member
  • Response Rate: 70%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: rose
  • Payment Methods : T/T, Western UnionBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Metal Clamp:Yes, No
  • Shape:Conical, Cylindrical, Circular, Other
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Is It Reusable:Non Reusable, Reusable
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Ot
  • ...
Show Attributes Hide Attributes

  • Petri Dish, Centrifuge Tube, Test Tube, Cuvette, Sample Cup, Pipette Tip, Drip Tube, Sputumn Cup from Zhejiang Plasmed Medical Technology Co., Ltd.
  • Model PDCTTTCSCPTDTSC-024
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 1100 Pieces
  • Delivery Time 18-19 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high volume
  • Certification tl9000
  • Rating 3.4 (7 reviews).
Price: USD 0.01/Pieces

Taizhou, China 1st Year
Free Member
  • Response Rate: 95%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: sai wang
  • Payment Methods : T/T, L/CBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Is It Reusable:Non Reusable, Reusable
  • Shape:Conical, Cylindrical, Circular, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Metal Clamp:Yes, No
  • I deal in:New Only, New and Second Hand, Second Hand O
  • ...
Show Attributes Hide Attributes

  • Lab Disposables,lab Consumables, Test Tube, Tips, Centrifuge Tube, Petri Dish, Freezing Tube,reagent Bottle, Cover Glass,slide,PCR Plate,slide Storage Box,deep Well Plate from Nantong Qingmao Lab Consumables Instrument Co., Ltd
  • Model LDCTTTCTPDFTBCGPSBWP-043
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 690 Pieces
  • Delivery Time 10-11 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high volume
  • Certification gsv
  • Rating 1.7 (19 reviews).
Price: USD 0.01/Pieces

Haimen, China 1st Year
Free Member
  • Response Rate: 70%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Tracy zhang
  • Payment Methods : T/T, EscrowBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Is It Reusable:Non Reusable, Reusable
  • Shape:Conical, Cylindrical, Circular, Other
  • Metal Clamp:Yes, No
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Ot
  • ...
Show Attributes Hide Attributes

  • Serological Pipette,pasteur Pipette,centrifuge Tube,cryovial Tube,sampling Loop,specimen Container,cell Spreaders from aude medical science & technology development co.,Ltd
  • Model SPPTTLCS-016
  • Price $0 Per Pieces
  • Minimum Order Quantity 1400 Pieces
  • Delivery Time 17-18 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity huge
  • Certification iso14001
  • Rating 2.5 (14 reviews).
Price: Inquire

Fengxian, China 1st Year
Free Member
  • Response Rate: 87%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Lee Lei
  • Payment Methods : T/T, Western UnionBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Is It Reusable:Non Reusable, Reusable
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Shape:Conical, Cylindrical, Circular, Other
  • Metal Clamp:Yes, No
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • I deal in:New Only, New and Second Hand, Second Hand O
  • ...
Show Attributes Hide Attributes

  • Petri Dish, Contact Lens Cases, Intraocular Lens Case, Centrifuge Tube, Labware, Lab Supplies from MB Plastic Industries
  • Model PDCLCILCCTLLS-051
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 840 Pieces
  • Delivery Time 3-4 Business Days
  • Shipping Port India
  • Packaging Standard
  • Capacity high volume
  • Certification fsc
  • Rating 1.9 (19 reviews).
Price: USD 0.01/Pieces

Noida, India 1st Year
Free Member
  • Response Rate: 99%
  • Currency: INR,USD
  • Language: English, Hindi
  • Contact Person: varun
  • Payment Methods : T/T, PayPalBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Metal Clamp:Yes, No
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Shape:Conical, Cylindrical, Circular, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • Is It Reusable:Non Reusable, Reusa
  • ...
Show Attributes Hide Attributes

  • Centrifuge Tube from Runlab labware manufacturing Co., Ltd
  • Model CT-016
  • Price $0.01 Per Pieces
  • Minimum Order Quantity 670 Pieces
  • Delivery Time 15-16 Business Days
  • Shipping Port China
  • Packaging Standard
  • Capacity high volume
  • Certification ohsas18001
  • Rating 2.7 (6 reviews).
Price: USD 0.01/Pieces

Taizhou, China 1st Year
Free Member
  • Response Rate: 71%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: Jackey
  • Payment Methods : T/T, EscrowBank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier
  • Automation Grade:Semi-Automatic, Automatic, Manual
  • I deal in:New Only, New and Second Hand, Second Hand Only
  • Material:Glass, Polypropylene, Borosilicate Glass, Plastic, Other
  • Is It Reusable:Non Reusable, Reusable
  • Shape:Conical, Cylindrical, Circular, Other
  • Type of Glassware:Heavy-Wall Glass, Quartz Glass, Other, Amber Glass
  • Metal Clamp:Yes,
  • ...
Show Attributes Hide Attributes

HK40 from Jiangsu Jingguo Machinery Heavy Industry Co. LTD | Model: H-376808358 | Price: $5.99 Per KG | Minimum Order Quantity: 500 KG | Delivery Time: 11-12 Business Days | Shipping Port: Jiangsu | Packaging: Standard

Price: USD 5.99/KG

Wuxi, China 1st Year
Free Member
  • Response Rate: 83%
  • Currency: CNY,USD
  • Language: English, Chinese
  • Contact Person: jinguo
  • Payment Methods : Bank wire (T/T)Bank wire (T/T)Letter of Credit (L/C)Doc Against Payment (D/P)Doc Against Acceptance (D/A)MoneyGramCredit Card (CC)PayPalWestern Union (WU)CashEscrow
Contact Supplier

Trending Centrifuge Tube Suppliers

from ChinaChina

lab equipment,test tube,centrifuge tube

Contact

from ChinaChina

Instrusments, Mini Centrifuge,Tissue Homogenizer,Vortex mixer,Shaker(Pendulum and Horizontal)Magnetics Stirrer,WB Electrophoresis Tank,centrifuge tube/pipette tip/ zircon grinding beads/ wet box/ WB antibody incubation box/adhesion microscope slides/staining raccentrifuge tube/pipette tip/ zircon grinding beads/ wet box/ WB antibody incubation box/adhesion microscope slides/staining rackk

Contact

from ChinaChina

pipette tips,centrifuge tube,cryo tube,pcr tube,pcr plate,cryo rack

Contact

from ChinaChina

Test Tube,Centrifuge Tube,Pipette Tip,Pasteur Pipette,Petri Dish

Contact

from ChinaChina

centrifuge tube petri dish petri dish spreadertiptransfer pipetteurine containerswab tube washing bottle microscope slidesmicroscope cover galss

Contact

from ChinaChina

Disposable Lab Consumables,Universal Filter Tips,Universal Pipette Tips,Centrifuge Tube,PCRproducts

Contact

from IndiaIndia

Micro Centrifuge Tubes, Centrifuge Tube Conical Bottom Self Standing (Skirted type), Racked C.T. Tubes, Micro Tips, Racked Micro Tips, Micro Tip Box, Serological Pipettes sterile, Cryo Vial Sterile, Ria Vial, Sample Container, Beakers with/without Handle

Contact

from ChinaChina

petri dish, centrifuge tube, test tube, cuvette, sample cup, pipette tip, drip tube, sputumn cup

Contact

from ChinaChina

serological pipette, pasteur pipette,centrifuge tube and so on

Contact

from ChinaChina

Chromatography consumables,life science consumables,syringe fiters, spe columns, sample vials, membrane filters, centrifuge tube, pipette tips,Serological Pipette

Contact
1
2

Explore More Lab Instruments & Supplies Suppliers

Upcoming Trade Shows

ANALIZA

ANALIZA

2021-03-01 to 2021-03-01
TLV Convention Center - Tel Aviv Fairgrounds
Contact
SPARK

SPARK

2021-04-01 to 2021-04-01
Zara Expo Amman
Contact
FIIEE - MINAS GERAIS

FIIEE - MINAS GERAIS

2021-07-20 to 2021-07-23
São Paulo Expo Exhibition & Convention Center
Contact
LIGHT SPACE DESIGN

LIGHT SPACE DESIGN

2021-03-16 to 2021-03-16
Melbourne Exhibition & Convention Centre
Contact
SIMER

SIMER

2021-09-29 to 2021-09-30
La Halle de Martigues
Contact
AUTOMATION & ELECTRONICS ZÜRICH

AUTOMATION & ELECTRONICS ZÜRICH

2021-09-29 to 2021-09-30
Ferienmesse Zürich
Contact
ANALYTICA

ANALYTICA

2021-03-31 to 2021-04-03
Fairground Messe München
Contact
CLEANROOM EXHIBITION

CLEANROOM EXHIBITION

2021-04-01 to 2021-04-01
ICEC (Istanbul Lotfi Kirdar Convention & Exhibition Centre)
Contact
LIGHTEXPO AFRICA - RWANDA

LIGHTEXPO AFRICA - RWANDA

2021-05-20 to 2021-05-22
Kigali Convention Centre
Contact
ELTEC NÜRNBERG

ELTEC NÜRNBERG

2021-05-18 to 2021-05-20
Exhibition Centre Nuremberg
Contact
LIGHTEXPO AFRICA - RWANDA

LIGHTEXPO AFRICA - RWANDA

2021-05-20 to 2021-05-22
Kigali Convention Centre
Contact
CLEANROOM EXHIBITION

CLEANROOM EXHIBITION

2021-04-01 to 2021-04-01
ICEC (Istanbul Lotfi Kirdar Convention & Exhibition Centre)
Contact
CHEMBIO FINLAND

CHEMBIO FINLAND

2021-04-14 to 2021-04-15
Helsinki Fair Centre
Contact
ELASIA

ELASIA

2021-04-23 to 2021-04-25
Bangalore International Exhibition Centre (BIEC)
Contact
ELTEFA

ELTEFA

2021-04-20 to 2021-04-22
New Stuttgart Trade Fair Centre
Contact
LABVOLUTION

LABVOLUTION

2021-05-04 to 2021-05-06
Deutsche Messe Hannover
Contact
CHEMBIO FINLAND

CHEMBIO FINLAND

2021-04-14 to 2021-04-15
Helsinki Fair Centre
Contact
ELEKTROTEC

ELEKTROTEC

2022-01-01 to 2022-01-01
Codissia Trade Fair Complex
Contact
MATELEC

MATELEC

2021-11-01 to 2021-11-01
Ifema - Parque Ferial Juan Carlos I
Contact
ANALYTICA

ANALYTICA

2021-03-31 to 2021-04-03
Fairground Messe München
Contact
ELTEC NÜRNBERG

ELTEC NÜRNBERG

2021-05-18 to 2021-05-20
Exhibition Centre Nuremberg
Contact
ELECTRA MINING AFRICA

ELECTRA MINING AFRICA

2021-06-09 to 2021-06-11
Expo Centre Nasrec, Johannesburg
Contact
ANALIZA

ANALIZA

2021-05-26 to 2021-05-27
TLV Convention Center - Tel Aviv Fairgrounds
Contact
AUTOMATICA

AUTOMATICA

2021-03-01 to 2021-03-01
Fairground Messe München
Contact
ANALYTICA

ANALYTICA

2021-03-31 to 2021-04-03
Fairground Messe München
Contact
FIEE

FIEE

2021-07-20 to 2021-07-23
São Paulo Expo Exhibition & Convention Center
Contact
TAIPEI MANUFACTURING TECHNOLOGY SHOW - MT DUO

TAIPEI MANUFACTURING TECHNOLOGY SHOW - MT DUO

2021-04-01 to 2021-04-01
Taipei Nangang Exhibition Center
Contact
CONGRES INTERNATIONAL DE METROLOGIE

CONGRES INTERNATIONAL DE METROLOGIE

2021-09-01 to 2021-09-01
Paris Expo Porte de Versailles
Contact
LIGHT SPACE DESIGN

LIGHT SPACE DESIGN

2021-03-16 to 2021-03-16
Melbourne Exhibition & Convention Centre
Contact
ELEKTRONIKMÄSSAN

ELEKTRONIKMÄSSAN

2021-03-01 to 2021-03-01
Svenska Mässan - Swedish Exhibition & Congress Centre
Contact

Related Centrifuge Tube Manufacturers

Related Centrifuge Tube Suppliers

Related Centrifuge Tube Buyers

Related Centrifuge Tube Importers

Hot products related to Centrifuge Tube

Centrifuge Tube Stats

There are total 282 trusted centrifuge tube companies. These include: 85 - Manufacturers, 56 - Exporters, 28 - Wholesalers, 71 - Suppliers, 17 - Retailers, 8 - Buying Houses, 11 - Traders, 3 - Services, 3 - Others, There are 346 centrifuge tube importers and buyers on ExportHub. Out of these, 138 needs one time, 7 needs on weekly basis, 14 needs on monthly basis, 35 needs on quarterly basis, 48 needs on six months basis, 104 needs on yearly basis The top centrifuge tube exporting countries include: China, India, Vietnam, South Korea, Taiwan The top centrifuge tube importing countries include: Canada, Australia, Turkey, Germany, India The price range of top centrifuge tube products is between 0.001-0.015 USD. The minimum order value of centrifuge tube buyers on ExportHub is 0.001 USD while the maximum Order Value is 0.465 USD. The total business generated in centrifuge tube category is 417992 USD last month. The top varieties of centrifuge tube products include microcentrifuge tube, eppendorf tube, ultracentrifuge tubes, conical tube. There are total 8 paid members of centrifuge tube on ExportHub. Out of these, 2 are Standard members, 4 are Gold members and 2 are VIP members. ExportHub Buyer Consultant Team has Connected 58 buyers and suppliers recently. Approximately 98 new buyers of centrifuge tube join ExportHub every month.

B2B Marketplace Trends & Tips

How B2B Digital Leaders Succeed to Grow Faster than their Peers
How B2B Digital Leaders Succeed to Grow Faster tha...
The B2B industry is never going to stop growing; same is the case with pioneers of the industry who know how to maintain a benchmark in such competitive niche. Use of digital techniques and technologies is rapidly increasing to ke
5 Optimal Tools for B2B Sales Professionals
5 Optimal Tools for B2B Sales Professionals
Believe it or not, 80% of B2B marketers report that all their efforts geare
How To Carefully Segment Your Market - B2B Marketing Ideas 2020
How To Carefully Segment Your Market - B2B Marketi...
Are you thinking about how to segment a market and identify B2B market segments carefully? Segmentation caters to effective and precise targeting. Apparently, the accur
Must-Attend events of 2018 to Add Value in Your eCommerce Business
Must-Attend events of 2018 to Add Value in Your eC...
Time flies in a blink, we have moved into the new business year of 2018. As 2017 began to wind down, my eyeballs started searching for e-commerce events in the next year. In this regard, I have found out some key events in 2018, f

We use cookies to ensure that we give you the best experience on our website. If you continue to use this site we will assume that you are happy with it.

Scroll